PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.25993s0196.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family HD-ZIP
Protein Properties Length: 781aa    MW: 85559 Da    PI: 6.6925
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.25993s0196.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.95.6e-2196151156
                           TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
              Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                           +++ +++t++q++eLe++F+++++p++++r +L+++l+L+ rqVk+WFqNrR+++k
  Bostr.25993s0196.1.p  96 KKRYHRHTPQQIQELESVFKECPHPDEKQRLDLSRRLNLDSRQVKFWFQNRRTQMK 151
                           688999***********************************************999 PP

2START1823.2e-573025281205
                           HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S... CS
                 START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla... 77 
                           ela++a++elvk+a+ +ep+W +ss    + +n++e+ ++f++  +     + +ea++++g+v+ ++  lve+l+d+  +W e+++   
  Bostr.25993s0196.1.p 302 ELALSAMDELVKMAQTSEPLWLESSkgkrKLLNREEYEKIFTPCLGpkpdeFVSEASKEVGMVIINSLALVETLMDSE-RWAEMFPcmi 389
                           57899********************99999999********88666999999**************************.********** PP

                           .EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--....-TTSEE-EESSEEEEEE CS
                 START  78 .kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe...sssvvRaellpSgilie 155
                            + +t e issg      gal+lm+aelq+lsplvp R ++f+R+++q+ +g+w++vdvSvd ++++      + +  +++lpSg+l++
  Bostr.25993s0196.1.p 390 aRNSTSEIISSGmggtrnGALHLMQAELQLLSPLVPvRQVTFLRFCKQHAEGVWAVVDVSVDRNSDRGGsasAQTSLSCRRLPSGCLVQ 478
                           *****************************************************************9987777778999*********** PP

                           EECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
                 START 156 pksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                           +++ng+skvtw++h+++++ ++h l+r+lv+sgla+g k+w ++lq qc+
  Bostr.25993s0196.1.p 479 DMPNGYSKVTWIDHTEYDDTHIHHLYRPLVSSGLAFGSKRWISALQGQCK 528
                           *************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.07E-2081153IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.6E-2184153IPR009057Homeodomain-like
PROSITE profilePS5007117.63793153IPR001356Homeobox domain
SMARTSM003893.2E-1994157IPR001356Homeobox domain
CDDcd000861.98E-1896153No hitNo description
PfamPF000461.3E-1896151IPR001356Homeobox domain
PROSITE patternPS000270128151IPR017970Homeobox, conserved site
PROSITE profilePS5084841.339293532IPR002913START domain
SuperFamilySSF559611.51E-27296529No hitNo description
CDDcd088759.92E-113297527No hitNo description
PfamPF018521.0E-49302528IPR002913START domain
SMARTSM002341.2E-44302529IPR002913START domain
SuperFamilySSF559614.94E-21557772No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 781 aa     Download sequence    Send to blast
MDFSGFLHHD DDNSSGGGNH FSSSAAMSGG LAKSIFSSPR LSLGLQQTNG EATRTGESFE  60
VSISRRSPES RSGSDNAEAL SGDDDLDASD RPLKKKKRYH RHTPQQIQEL ESVFKECPHP  120
DEKQRLDLSR RLNLDSRQVK FWFQNRRTQM KTQIERHENS LLRQENDKLR AENMSAREAI  180
RNPMCGHCGG SAVLGEISLE EHHLRTENSR LKDELDRICA LAGKFLNRSD DEATGSHQLP  240
NSALKLGVGT NNGYGGGGGG GGFTLVPPGF EILSPFFSGL AAPVNRTTDV ATGLDQKSLY  300
LELALSAMDE LVKMAQTSEP LWLESSKGKR KLLNREEYEK IFTPCLGPKP DEFVSEASKE  360
VGMVIINSLA LVETLMDSER WAEMFPCMIA RNSTSEIISS GMGGTRNGAL HLMQAELQLL  420
SPLVPVRQVT FLRFCKQHAE GVWAVVDVSV DRNSDRGGSA SAQTSLSCRR LPSGCLVQDM  480
PNGYSKVTWI DHTEYDDTHI HHLYRPLVSS GLAFGSKRWI SALQGQCKSL TILMSSTIPN  540
RDKPTPISSL GKKSMLKLAQ RMTQKFCRGV CASSSQKWSK LEIGNIDEDV RIMTRKNVDD  600
SGEPPGILLS AATSVWVPVP PRRLFDFLRD ELLRSEWDIL SNGGPMQEIA TIFKGQDQSN  660
SVSLLRSTAM NAIQSSMLIL QETSIDASGA IVVYAPVDIP AMHSVMNGAD SAYVALLPSG  720
FAILPDGQGM EENGSLLTVA FQILVNSLPT AKLNVESIET VNNLISCTVQ KIRAALRCDK  780
*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006293718.10.0hypothetical protein CARUB_v10022677mg
SwissprotQ9M2E80.0HDG1_ARATH; Homeobox-leucine zipper protein HDG1
TrEMBLR0FVJ90.0R0FVJ9_9BRAS; Uncharacterized protein
STRINGBra004934.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM112827105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61150.10.0homeodomain GLABROUS 1